DPCstruct | MC25872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 122 ± 18 aa |
| Standard deviation of domain lengths | 17.76 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R6YBB8 | 1-135 | MATASLLHWTLNVVFRLPTILRNTCVLIAPIFGVGTTVATYLLTKDVTCRASTALVAAVIVAVVPAYTSRSVGGSYEVMSIFALVIT… |
| A0A484CR75 | 433-540 | ITSAVLYHTLHFFHITIDIRNVCVFLAPLFSSFTAIVTYHFTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTY… |
| A0A2T7PF01 | 403-510 | None |
| A0A0N4Y5R8 | 95-207 | None |
| A0A183DQP0 | 55-202 | None |
| A0A4Z2FLR0 | 99-210 | None |
| A0A5J4W627 | 76-181 | None |
| A0A7I8VU91 | 593-707 | None |
| A0A183WN42 | 6-158 | None |
| A0A7J3NMC9 | 103-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.