DPCstruct | MC25861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 117 ± 22 aa |
| Standard deviation of domain lengths | 21.74 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09524 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q5ZH24 | 2-85 | EETEILNFLNEVTGSKFREIKSNISKISALLKQNFTKEQIIEVIQLKVIQWKNNPKMAMYLRPSTLFLERNFENYINEIERIKQ |
| A0A1G0GYE4 | 109-235 | QEQKQEQEQKQEKEIGCANPAFSLSESNNFNSIQSYQSSAIEVLQFLNEYANKAYEPTKEHLSHIIQRLKEGERVDVCRAIIVRKSN… |
| A0A6M3LG03 | 28-149 | None |
| A0A6M3LHH8 | 139-219 | None |
| A0A6N9JJ88 | 75-179 | None |
| A0A7X0VQL7 | 52-188 | None |
| A0A1Y4F4F2 | 6-92 | None |
| A0A520XFJ8 | 6-170 | None |
| A0A1V4WUH5 | 104-202 | None |
| A0A1E7IC66 | 207-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.