DPCstruct | MC2586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 132 ± 17 aa |
| Standard deviation of domain lengths | 16.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A556C4Q2 | 189-318 | PAMYGSRYELGMSTTEAAKAIRADIKDAKTTGYLPNDLTYSVRKSSASAMSIEVQGLTNDQIYAPADDMEPAYLGRRHRPEAAELKD… |
| A0A523V9A1 | 3-145 | RDFKGSKYAETKDLDLAEIAKLVRADIKAAVKAGDLPKGTKTSVRISRYSMGQSLTATITECPGLIVANPDRVRFDLDDPHGHTTLP… |
| A0A7W6BPA5 | 22-131 | None |
| A0A1G9QZE2 | 25-148 | None |
| A0A0F9BYQ2 | 4-130 | None |
| M2AR65 | 79-235 | None |
| A0A7X0DNZ3 | 48-189 | None |
| A0A4R6RS65 | 160-337 | None |
| T3D328 | 69-203 | None |
| A0A1C2J497 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.