DPCstruct | MC25854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 7.30 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.15 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | CL0179- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3UEB7 | 22-97 | IVEDITVQVGRTGALTPVAVLKPVLVAGSTISRATLHNEDEIKRKDIRIGDTVVVRKAGDVIPEVASVLKDMRTGR |
| A0A0E9LU10 | 1-75 | MISVDFQVGRTGAVTPVANLEPVPLAGTTVKRASLHNADIIDGLDLHLNDMVSVEKGGEIIPKITAVDLAQRPVN |
| A0A379WQ23 | 81-148 | None |
| A0A365VN64 | 11-94 | None |
| A0A842T7L5 | 1-77 | None |
| A0A837I3J9 | 2-65 | None |
| A0A7V4UW92 | 81-165 | None |
| A0A0K2QZV3 | 73-160 | None |
| A0A4U9R6B9 | 927-1014 | None |
| A0A485AZ12 | 152-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.