DPCstruct | MC25852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 244 ± 21 aa |
| Standard deviation of domain lengths | 20.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 19.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832VIP1 | 4-258 | TRKDAQKSIDEAKRIIEQARSIVIGDKLSKDTNFNVAVMINLLAASKAEYAEGVKNGKIAEMIEFQDGSSFVWRSQQIFEKIKPDLP… |
| A0A6A7SL60 | 7-216 | TYVSDARAMTETASGLADAYARGEAADPQALIDKWESVKLHAAVETTAATIYSSIWQGIYGVKEAIEKERPDEAVREQVDALDHALW… |
| A0A3M9ZS55 | 119-392 | None |
| A0A6N2TE07 | 188-441 | None |
| A0A7J4RT98 | 64-325 | None |
| A0A2H9RQX7 | 270-506 | None |
| K0ZHA6 | 32-262 | None |
| A0A2A2FA91 | 39-266 | None |
| A0A4U9TZC7 | 147-433 | None |
| A0A3N9TBR7 | 128-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.