DPCstruct | MC2585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 146 ± 22 aa |
| Standard deviation of domain lengths | 22.22 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08349 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7L4X8 | 152-284 | AIKCINLLSKKKNIKYLEQEWSRYNYSVLEKSHKDYLDIRQMLKDKSAYPVKEFYCKIEDVLNFDESIPSAVNALQHVWGYFKNKAE… |
| A0A1S6U7U0 | 58-201 | YKDIFEFLQTKPSFKSLIEFHASYKYLIYSKSHKHYKQLGNIVANRSKKSLCKVLDEYKIIFLDAISLKESIAKTYNIFLHMYGYFK… |
| A0A7S1MSI6 | 230-459 | None |
| A0A376UFR3 | 11-149 | None |
| A0A2Z4FQT6 | 95-254 | None |
| A0A523JU11 | 346-526 | None |
| A0A4V5PYM9 | 42-187 | None |
| A0A2K3IYH7 | 11-158 | None |
| A0A2N1QKC4 | 9-149 | None |
| M1PVQ5 | 106-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.