DPCstruct | MC25846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 192 ± 33 aa |
| Standard deviation of domain lengths | 33.37 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.90 |
| Pfam Score | 95.12 |
| Assigned Pfam label(s) | CL0018- PF14144- CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833V1V2 | 6-166 | WTSTTENIFMWVGGWRPSAAFHLFHSKSGMQLEARLEEIIRGGAVKDLGDVSATQLQALDRLQRETVRAERLISEEAAEAQEALAAA… |
| A0A1Y1I4E5 | 31-254 | LEAQRNADVLPQDVQPHVDLWNELGSAKAKAIEGDVLYMAAGLWQTPFERAFSWLGGVRPTIMFQLIYSQIGAQTSRSLAALLEGEE… |
| A0A445IUS6 | 468-667 | None |
| A0A6J0PAJ7 | 2-169 | None |
| A0A251T440 | 1-195 | None |
| A0A166BZR8 | 1-170 | None |
| A0A6D2J604 | 4-241 | None |
| A0A4Y7LEX6 | 300-562 | None |
| A0A835HDU7 | 12-201 | None |
| A0A7J7M9S0 | 7-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.