DPCstruct | MC25844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 230 ± 61 aa |
| Standard deviation of domain lengths | 61.23 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 72.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14388 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9QMT2 | 53-251 | CNFSTTTPNALTASRIVMMDAFRQYFDYKMIGACGIPKITLLGTVQDWQSICDRVRMMAEYNLNWWTDRLLPICEELVNTASGHPSL… |
| A0A1Y1I2S3 | 22-276 | EQTKQNVRELVECDFSTTGLVELTVSQLALMDAMQPYFNYHMCVCGIPKITLTGTVEDWKKVRAKAAALAAYDLDWWLQELLPILDH… |
| A0A813UXS4 | 4-155 | None |
| R1D4P3 | 7-147 | None |
| A0A5J4VGM9 | 187-476 | None |
| A0A7S4K388 | 6-229 | None |
| A0A2Z6RSS1 | 33-219 | None |
| A0A1L7VSN7 | 38-422 | None |
| A0A1G2I2A7 | 41-263 | None |
| A0A146I7X1 | 812-1089 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.