DPCstruct | MC25838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 257 ± 44 aa |
| Standard deviation of domain lengths | 44.38 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 18.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08559 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N7ZBN8 | 1-202 | MMQMSPILKKCRSLTVSPAQSPPEVAIKGLSQNQLVEVLSHVLNRHPELKDEVSDILPQPDLKEMEEKLNLQKKCVFKSLPISRLTS… |
| A0A1Y1HPI6 | 2-231 | ASPALSDGSYEPEVDPEGSSFSDDVLGSASEIKPKQKRVAAGKKPTAAKAPALPKLLKAFDNEQLIQLILKMVAEKPELQARVLENL… |
| A0A1X2IP37 | 1-277 | None |
| A0A1E3PAP6 | 48-316 | None |
| J9M275 | 30-277 | None |
| F4RAE2 | 48-362 | None |
| A0A6P8IQM2 | 24-308 | None |
| C1MGJ3 | 3-163 | None |
| I2H3J9 | 61-376 | None |
| A0A834XWQ5 | 76-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.