DPCstruct | MC25836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 103 ± 10 aa |
| Standard deviation of domain lengths | 10.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 48.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11443 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484MGK7 | 363-460 | QGYLESVKKGEAKIAAGALLPHEIIQALNDGEADGGEVAELQWKRMVDDLLQRGKLRNCMAICDVSGSMTGIPMEVSVALGVLVSEL… |
| A0A565CKT9 | 118-213 | EQYLEDAKSGKTKIAAGAVLPHEIIGELNGGDGGQVAELQWKRMVDDTRKKGSLTNCIAISDVSRSMSGTPMEVSVALGLLVSELSE… |
| A0A6J5UXD5 | 132-232 | None |
| A0A6P5S3J5 | 384-491 | None |
| A0A1J6J3S9 | 320-422 | None |
| A0A314YX87 | 246-365 | None |
| A0A6J5WJK7 | 5-116 | None |
| A0A444X7B1 | 127-215 | None |
| A0A843XC89 | 156-250 | None |
| A0A5N5HZ94 | 293-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.