DPCstruct | MC25834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 111 ± 17 aa |
| Standard deviation of domain lengths | 17.27 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7Y7I3 | 1-94 | MEMKHLSSIANDVICRCAQKLDTSVDKIVHEFEAGWEPEMEGYSRKLVEFCCSKALIDMCSELEETIDDGSFIRFTFDMMLAWEMPT… |
| A0A6J5XZ02 | 1-117 | MANRLKHLSSIANDVVQSCALKLETPVEKLVEEFETTWKADETAPVGHNITATNNNNNSYGRKFVEFCSAKVLQTRDICKTIEEKIA… |
| A0A445F009 | 91-185 | None |
| A0A287UCP5 | 1-147 | None |
| A0A2U1PZQ3 | 1-104 | None |
| A0A1D6Q5P6 | 2-140 | None |
| A0A4S4E0X2 | 23-136 | None |
| A0A540MBQ5 | 2-118 | None |
| Q7X635 | 3-121 | None |
| A0A1U7YGL5 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.