DPCstruct | MC25831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 255 ± 19 aa |
| Standard deviation of domain lengths | 18.90 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 69.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A329RED7 | 1-247 | MGDSIATTLALPLLWAALEPPDNYQYPLLLSKLKQKILCAYTNAGGSPDLNPVKRKEFFITGGGSQLSLVVSNSSESAVEESNTSTA… |
| A0A024TVX5 | 1-253 | MYAAVQSTSTFDSEYPLLPEPLQQSILNSIRLAANIDVDSDVPQFVEKVAILPSGFGGDLRLVDMRGEMAELGGQATSTTTVMAALL… |
| A0A6G0SME5 | 1-271 | None |
| A0A7S2KS93 | 463-742 | None |
| W2ZSF8 | 203-446 | None |
| A0A2D4BWS1 | 72-336 | None |
| A0A2D4BU04 | 73-326 | None |
| A0A0L0G9L9 | 2-213 | None |
| A0A225VB37 | 170-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.