DPCstruct | MC25830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 216 ± 29 aa |
| Standard deviation of domain lengths | 28.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067CT89 | 10-213 | ASFKVWARLLANLTAYISVSLSLCSSVVAIGAGALNRRLLFYSVENDVFHPLSQSCLLTSTGFAPNSCSRAEWSLLATPAAWVATGN… |
| A0A024TID1 | 1-208 | MAGQHNGGRRRARPKLSATYISKWLRVLSNIFAGVLILGTGVLVLLLLYQGMFYSQWIRPMALDKWNPMFKSCRLDALGFVPGTCDD… |
| A0A067C800 | 1-232 | None |
| A0A485KCA6 | 46-286 | None |
| A0A397A084 | 188-390 | None |
| A0A418AQF8 | 3-178 | None |
| A0A1V9Y5Q4 | 1-226 | None |
| A0A6G0XB98 | 4-237 | None |
| A0A067BYE7 | 15-174 | None |
| A0A1V9ZNZ3 | 3-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.