DPCstruct | MC2583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 183 ± 24 aa |
| Standard deviation of domain lengths | 23.68 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10978 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W2TJ74 | 90-291 | SYWLRNEHLSQAIHIKMFNYLTRVLESKVTDTFGVYQSFSILVLAEVVRVDRHSPFLTADQRDYLVNVGTSFLTNVKDYRGFSTKTG… |
| A0A6M0Q8X1 | 12-182 | FTRSFSALVIVLVLKKDRQKRFLSDEMLKQAIEDSIKYLKLEEDIRGYVVEKGWAHSIAHGADLLKEAISHPNFNIKLSSKCLETIK… |
| A0A4F2S9I5 | 5-163 | None |
| A0A3M0MRK7 | 5-171 | None |
| A0A5N1ID26 | 27-233 | None |
| A0A223KS96 | 199-399 | None |
| A0A1I0B4H8 | 11-158 | None |
| A0A4Q4D0V0 | 59-249 | None |
| A0A3P5XH93 | 228-431 | None |
| A0A268AE41 | 22-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.