DPCstruct | MC25829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 81 ± 14 aa |
| Standard deviation of domain lengths | 13.60 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813D4J7 | 112-185 | AANAENWREKVRCQRETLRDERLRKRGAAMKLPEGKVWFEASLDWREVPSNGICPGGLEYRCDMQTSRNYARLP |
| A0A024THI5 | 9-90 | LVVLTALHARNHRGSTSDTDMGSSVIVLRGASGIDHPLPAAPIDLFEPTDEWKEIGLNQQLPGGLWIRINLSTGKKEARNLP |
| A0A812DKF3 | 1-62 | None |
| A0A7J6SBN0 | 222-305 | None |
| A0A3Q4MRP2 | 19-112 | None |
| L9JUK6 | 37-104 | None |
| A0A817PDZ4 | 16-66 | None |
| A0A6G0X4F7 | 4-71 | None |
| A0A067C7L1 | 1-61 | None |
| K3WKB1 | 8-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.