DPCstruct | MC25823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 7.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0213 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7FMJ0 | 7-68 | TPYKIGDPCSDCPDACDNGLCTNPCLYEDTYSLCPQLKEQYTCNNRFVLKYCVASCQCTTKI |
| A0A444TVE5 | 16-102 | FGLQLIRGNHLSSLSTPYKKGAPCSSCEGHCKARKLCKNSCSYGDIWINCKELDFAFHNWLCNSKKTKQGLQRFRHCKATCLCKNKI |
| A0A7J7WUT7 | 292-360 | None |
| E9ISB0 | 1-86 | None |
| A0A0N7ZA67 | 367-452 | None |
| A0A2K6L7K9 | 83-152 | None |
| A0A402FFY7 | 220-290 | None |
| A0A182QW82 | 320-401 | None |
| A0A1D1VUF1 | 350-419 | None |
| A0A0L7LEN1 | 108-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.