DPCstruct | MC25822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 394 ± 104 aa |
| Standard deviation of domain lengths | 103.97 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 81.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.89 |
| Pfam Score | 79.45 |
| Assigned Pfam label(s) | CL0164- CL0059- CL0159- CL0353 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522BXD1 | 73-519 | RTLDAAIALLAAGGHDDVLGVTLTSATSADAVAAYTQGVPFDADDAAYAGATAKLAFVVEAAGLDATDVAEVDLLAQLLSLVTPEGR… |
| A0A444TVB2 | 79-427 | FESVGKVLHKGMKGGLSGSDSPSLLTSFVLISLIEAGESSSSTAVSEALFCINAAKPTTNPYSLAVKAYALALANSPDTQAALDQLL… |
| A0A7X3RIK3 | 28-362 | None |
| A0A6V7WQA3 | 493-971 | None |
| A0A7N8XKY6 | 52-387 | None |
| A0A3P9HA43 | 3-300 | None |
| A0A182KGY2 | 80-532 | None |
| A0A3Q3XBM9 | 16-330 | None |
| A0A4Y2TV32 | 32-300 | None |
| F1Q4X5 | 967-1538 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.