DPCstruct | MC25820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3 |
|---|---|
| Mean domain length (aa) | 439 ± 27 aa |
| Standard deviation of domain lengths | 26.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 71.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817F7Y6 | 208-609 | YSKHSSRPTGDDDEDSFGLHGDDADYADTGGNEQLQTSTNQNSMPANERLRGYPNEDYLVVHLNTLITFSFMSCTSTSDQLRLSGLS… |
| A0A7S4UYX5 | 296-758 | NDTDEGADDDDDDFTPMGVVEDAKSRARDDVLLVLGRVSPCRWQIKCQAAQLAGFVLSELGRHHLQNGNKESAHFDLIAARALCAKR… |
| A0A3M7SDD9 | 12-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.