DPCstruct | MC2582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 97 ± 9 aa |
| Standard deviation of domain lengths | 9.28 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 49.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453IY23 | 48-136 | YKRLLCSVDLTKDFFFSYSYNIMRSLQKNINDKNTGHVVYETMFVWNEFLTRAMRNHLKNTDWTVALVHGFFKQSKLSVSGKDFWLT… |
| A0A0D2SGZ7 | 7-110 | FVVSFLFRYKKLLSSVDLTQDFFFCYSYNVMCSLQKNLYNNEPGEVLYETMFVWNEFLTRGISNPLKNTLWTVTLVYGFFKQASFSV… |
| A0A5D3CST9 | 188-285 | None |
| A0A6S7N7E9 | 20-106 | None |
| A0A2G3CNP3 | 2-92 | None |
| A0A820U0K9 | 1-117 | None |
| A0A5J5RX02 | 14-108 | None |
| A0A6A6LVD5 | 163-251 | None |
| A0A4U6TIS1 | 42-124 | None |
| A0A453S2H8 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.