DPCstruct | MC25819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 53 ± 3 aa |
| Standard deviation of domain lengths | 3.41 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 66.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 69.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8XUE6 | 1-62 | MCNKLLDSMTCCEHQAELFCRQCHCRRYGPKGVGFGIGAGSLTMDTGEQFGNKEVDMTSVIA |
| A0A444TNL9 | 3-57 | ETNKGMCNKMLDSTNVNCHETVLYCKTCHGRKFGPKGYGFGGGAAGLSMDSGDHL |
| A0A2A3E5F8 | 298-348 | None |
| A0A448XFE3 | 1-56 | None |
| A0A183X000 | 8-64 | None |
| A0A2A2K8H8 | 41-93 | None |
| A0A7R9L0I0 | 466-518 | None |
| A0A2P8ZI38 | 1-53 | None |
| A0A2T7PL60 | 6-55 | None |
| A0A0D6LRB7 | 75-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.