DPCstruct | MC25818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 250 ± 40 aa |
| Standard deviation of domain lengths | 40.39 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14075 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444TMH6 | 1-208 | MTENRKELKLLKGSSESESEEEKGEQLEKGIENKIEEQIGENEEEICASNDNEANLSDDNDRESILPSDLPQDIVAVIDKLKEVGKN… |
| A0A2N1JD58 | 458-694 | DTAAPESASTTPADKAEKKKNKYPIQPVHPDLQKRFDHLKTLVQRASFAVKTKFPPELKPPLIETAKLAVELDEYNENFFNYLPSIF… |
| A0A3P8FMS2 | 9-251 | None |
| A0A177B2Z2 | 124-360 | None |
| A0A6A4WQ01 | 260-509 | None |
| E1B7L7 | 356-610 | None |
| A0A183QVE1 | 153-395 | None |
| A0A166HRK6 | 276-648 | None |
| A0A1S3I8Q8 | 249-492 | None |
| A0A1Y1NBW1 | 265-485 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.