DPCstruct | MC25817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 427 ± 79 aa |
| Standard deviation of domain lengths | 78.84 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 67.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.10 |
| Pfam Score | 80.83 |
| Assigned Pfam label(s) | PF14641- PF14632 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1C650 | 2-432 | NSIPFNLHIPLDIRDFIVDDRANEAPTKAPRRIVHKGAALQQAQSIFGVDFDMSEFEAFRKGPAEGDEYSEESEPEYSDDEEATARP… |
| A0A388KCG4 | 4-411 | AIRELELDEDDYALLEENQGFRRPREVVKEKKQLKRLKKAGRAQGEDGEQITGEVSGDDDDHEERGAGRTAEEEIKRSLFGDDEGVA… |
| A0A1A9WFV4 | 1-255 | None |
| A0A1D6M791 | 100-582 | None |
| U7PWQ2 | 16-575 | None |
| A0A820AQZ2 | 85-608 | None |
| A0A7R9A5I3 | 49-510 | None |
| A0A6D2JBP6 | 23-473 | None |
| A0A183NFC1 | 41-488 | None |
| K7HUM5 | 56-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.