DPCstruct | MC25814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 95 ± 15 aa |
| Standard deviation of domain lengths | 15.00 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 39.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444TGY4 | 25-90 | GLTERTAVAPRLFCDICDCFDLHDTEECPRQTSGDSPPPTQYHADRHAVRKYCDSCEVFGHEEGEC |
| A7SRR6 | 1-71 | EPVNPRFKPRLFCDICDEFDLHDTDDCPTQCSGPPPEEEGVKHGGNRAEERPYCTICEVFGHWTHNCDDEE |
| A0A3P7LFN8 | 239-344 | None |
| A0A553NKR0 | 68-170 | None |
| S4P2B3 | 91-182 | None |
| A0A4E0S3R6 | 454-569 | None |
| A0A068YE46 | 298-414 | None |
| A0A183SGB7 | 438-511 | None |
| T1FZC7 | 41-131 | None |
| J9AW05 | 2-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.