DPCstruct | MC25813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 81 ± 12 aa |
| Standard deviation of domain lengths | 12.27 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 33.20 |
| Pfam Score | 98.65 |
| Assigned Pfam label(s) | CL0466- PF02953 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2MJ00 | 7-75 | MDAELQRFLAIEGQKAKFQQHVHNLTDICWDKCIEKSGSKLESKQQACLSNCVGRFIDVSNFVINRLSQ |
| A0A444TGR1 | 47-128 | GTSGRGGDAELQQFIAKEQQKAQLQAMIHRMNEMCWDTCVGTPESKLNSRTETCIANCVERFIDSSLFITNRFAQLLSKSGG |
| A0A7J7IBY5 | 58-134 | None |
| A0A0W4ZKV8 | 8-79 | None |
| A0A7M4F3N5 | 68-153 | None |
| A0A420IK50 | 6-83 | None |
| T1KUS1 | 3-82 | None |
| A0A438N2H8 | 23-123 | None |
| A0A6J0PPW8 | 5-85 | None |
| R9PDL0 | 2-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.