DPCstruct | MC25811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 137 ± 13 aa |
| Standard deviation of domain lengths | 12.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444TF72 | 27-154 | ESTLEISESTLESSEQIVSEVSSIDSNQFTLPNFSDFVIPYLQGENLCLKQKKTMRNIIIETLIEFLDKNNILTGKSKVHQALGYKT… |
| A0A4Y2LJG6 | 1-126 | MAGGRDVFETELDSTMSSVKSSQRPIKYFSLPDFSNVLQPLLNGDALSEKYHARLSSILKEELISFLNHENLISTGNTSTLRWEYRN… |
| A0A444T206 | 1-106 | None |
| A0A444T046 | 6-145 | None |
| A0A444SQN0 | 204-338 | None |
| A0A6P9FPQ3 | 120-267 | None |
| A0A5N5T1P8 | 1-136 | None |
| A0A444SEY0 | 144-291 | None |
| A0A444T9V6 | 49-196 | None |
| A0A6P7UG42 | 104-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.