DPCstruct | MC25810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 7.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 53.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03735 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444TEY8 | 26-102 | AWPMLLDMTKEECKKALRSLELSTYSKIVSVLRAQGELTKEKKKLLNDLQNMFAIPVERHRAEIRRAVNDEMLNTIA |
| A0A813TR17 | 7-74 | QRRSMATIKNMGVNSYSQIIAAFRAQGDLTEDQSNILPVLQNTLGISRERHTAEIKRALYDEQLTEIA |
| A0A7R8ZGU5 | 43-148 | None |
| A0A4Z2D781 | 8-95 | None |
| A0A7R8XEU1 | 1-85 | None |
| V4BGI1 | 1-82 | None |
| A0A3P7L9D5 | 9-98 | None |
| A0A653D200 | 1-79 | None |
| A0A183QB75 | 9-91 | None |
| A0A3S3P5X3 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.