DPCstruct | MC2581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 636 ± 54 aa |
| Standard deviation of domain lengths | 54.12 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482W0X8 | 5-528 | FLIVFYTTTADGGSTEQLSEIRTAFLQKYKSYHDVGLMQFEVPRESAYVRFEFTADDAIPGCKIEKVLLYIKHNSPPVINPDGSKFP… |
| A0A0D2SAS4 | 24-630 | LFGHCNSVEQLGGYDTFTISSFKYPETQIRPFDMHYIRVDLPPWFSSMSIALKSSVNLDIKSAKKVPKSVLPMICFRDGSLPLPDVS… |
| W4GZB2 | 1-582 | None |
| A0A7J7MSB4 | 10-695 | None |
| A0A2Z6NIX0 | 8-650 | None |
| A0A443REC1 | 330-995 | None |
| A0A833S5Q5 | 525-1165 | None |
| A0A446IST4 | 1-599 | None |
| A0A7J6YM02 | 166-901 | None |
| A0A151XBV2 | 7-666 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.