DPCstruct | MC25807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 575 ± 84 aa |
| Standard deviation of domain lengths | 83.83 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 69.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673ZXQ9 | 1-521 | MNMDIADEGDICRVCRSEGTPDKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPPRLPIQDICAGLLT… |
| A0A444T935 | 1-513 | MEEDGQNQDICRVCRCEGTSDRPLFHPCICTGSIKFIHQDCLVQWLRYSRKEYCELCKHRISFAPSIYSPDMPKRLPIADIISGLAR… |
| A0A0P0XBF7 | 15-585 | None |
| K1PGE1 | 1-584 | None |
| A0A7M7GFY8 | 1-655 | None |
| A0A0F4YSW3 | 248-729 | None |
| A0A6V7V5X1 | 1-573 | None |
| A0A1D6P438 | 4-717 | None |
| A0A182SL97 | 2-548 | None |
| A0A4S4MVB1 | 277-728 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.