DPCstruct | MC25806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 300 ± 65 aa |
| Standard deviation of domain lengths | 64.83 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 74.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 29.16 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | PF10498- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9W1J6 | 43-234 | INEAVENDVTAEAWQLELERVMPLLKVSIKSNSGDWRSHLEMMKTHQAGLSEISTLVTSNLGKISTDIENVMQKMGKREKLINSQFD… |
| A0A444T721 | 33-323 | NKLKPGWGENVIYVLDRLADFALKNTNFSWKQPVYPTEETEGEDDDIEDEAELTLEKVEEDMIDDMDDDDEEEENILHMDDLKDLTV… |
| G0NY00 | 25-251 | None |
| A0A674HR09 | 12-359 | None |
| A0A1W0A3K6 | 648-959 | None |
| A0A4Y2UWH3 | 54-314 | None |
| A0A803QBV7 | 1-432 | None |
| A0A482STV1 | 2-253 | None |
| A0A2D4P904 | 1-200 | None |
| A0A2A9M6B0 | 15-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.