DPCstruct | MC25805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 11.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09992 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9WK17 | 450-550 | RIHIRKVVITHAVIRNRRITWEAVNRTRSGGKTVLYNSLWGFETEPDPDYVDVSIVKGRVHHIREGGGVRIPLLGFVLSIPREKAKS… |
| A0A3N5M908 | 163-272 | KQLVTVLATGETIPITGINIPRKDNQLIVYTPQYDSDTNTDTSGVEILVEMAKPSQVIPLPRSTEGVVREIRDGLGSTPIPFDSIVL… |
| A0A1V5XG76 | 149-251 | None |
| A0A3L7D7Z8 | 256-367 | None |
| A0A0F3R7T3 | 30-120 | None |
| R6WD70 | 476-574 | None |
| A0A511N0E3 | 692-802 | None |
| A0A7C6PPM3 | 158-252 | None |
| A0A7C6YST2 | 104-197 | None |
| A0A7V4GBA2 | 188-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.