DPCstruct | MC25802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 5.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X9LKN8 | 49-118 | FGGGLAAGVAITAAQFVLGTTALNASNRFIYNTITGGLFFDGDGTGTLAAIQIATLSSKPTLTASNILVL |
| A5PAF3 | 2-56 | PNFQLGTEADDADDRIIYDQTTGNLYFDADGNGEGEQILVANLGKGTVLEYTGIF |
| A0A2W7C1D6 | 75-139 | None |
| A0A512BV44 | 222-284 | None |
| A0A1B3MLW1 | 1209-1276 | None |
| A0A4Q0MNH9 | 531-585 | None |
| A0A4V1KIW1 | 200-261 | None |
| A0A2W6T6N2 | 1130-1196 | None |
| A0A370HNW6 | 584-646 | None |
| A0A370HNZ9 | 641-709 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.