DPCstruct | MC25801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 131 ± 9 aa |
| Standard deviation of domain lengths | 9.08 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8M2L5 | 140-265 | IKVGTFTSDELFDAGGGGCGMTLWESKTDVQQAGFLFFHGIEDGAAFMVFDENLTTLSRTTAEGQEFYGQKTEQTFVTDDQAITVQV… |
| A0A654D7U9 | 87-224 | NAPEPAIGETQGGDGSEIALAPLQPDDAADLPGELACGFRLADARQSLMIARADVGDDARGVAVIRNGGYAERLMARSAGGFGAMER… |
| A0A0F9XP43 | 13-158 | None |
| Q3J4U6 | 93-216 | None |
| A0A1Q3ZLX8 | 90-224 | None |
| C6VUD7 | 21-140 | None |
| A0A7T7XEX2 | 136-257 | None |
| A0A6I5P4D6 | 151-278 | None |
| A0A086BIX8 | 26-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.