DPCstruct | MC25800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 196 ± 20 aa |
| Standard deviation of domain lengths | 19.84 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 17.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19614 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G9W975 | 1-195 | MDITKIGEFLIKVFNQYKSDKYKENFAWIDQIQNIKSSSEKEKLNSFLIESINNNSNQFWMAAPELVDWENIRGYKYHGKEIFDDID… |
| A0A077ASI3 | 1-201 | MIKKKDYKRKFPWIKNIRPITEKDTISNLQKCLLSAIKGETSETWYLSHPWNVDVTNRDSNIPAHYKLNSTRKRYSNLEEIADYLRN… |
| A0A1Y6FAI5 | 190-400 | None |
| A0A4R0JVJ8 | 137-343 | None |
| A0A6B1GK08 | 204-407 | None |
| A0A840GV92 | 26-242 | None |
| F2LAF3 | 2-180 | None |
| A0A483BD59 | 204-412 | None |
| F4PEX4 | 232-429 | None |
| A0A6M2ACD1 | 275-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.