DPCstruct | MC2580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 125 ± 10 aa |
| Standard deviation of domain lengths | 9.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D7R6E4 | 16-143 | LYNENKVVESWNDIIENFRSFQEIDNLEPSRVLQYYRSFFHWYYWPEEGLFAPSKFLGYKNSTIGSYDSSGTGGVTQKVLAKYFNKL… |
| A0A7X8PZ31 | 1-128 | MRIVENLKELQENIKTLDKYLNSKKDPEYSFGLGLIKKGTCFVAVKENNKYKFYPSRFIGYANNNMATHLNNELRDGRETNSAISII… |
| N2IQI1 | 1-105 | None |
| A0A844YSD0 | 1-148 | None |
| A0A3S4V4M8 | 109-235 | None |
| A0A525IDE7 | 53-175 | None |
| A0A847YIX7 | 2-129 | None |
| A0A1C7HBI6 | 22-124 | None |
| A0A1G9KTG6 | 262-383 | None |
| A0A5P2S9E1 | 2-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.