DPCstruct | MC258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 8.45 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3UYD7 | 1-68 | MNVINLCFQIMPEPDQAHGCAHGSCYPATGDLLVGREKNLKASSTCGMRKKERYCIVSHLQVSVCHSL |
| A0A3Q3G7R8 | 2-83 | SLLIHFVTFLALWWPCCRAQFPEFTDVCTEGSCYPATGDLLIGRAHKLTASSTCGLKHPEKFCIVGHLEVSKSSCLKIRKKT |
| A0A3Q3VR13 | 15-80 | None |
| A0A673I5D1 | 6-70 | None |
| A0A7J5ZC44 | 56-134 | None |
| B4E0S2 | 5-81 | None |
| A0A4W5J9W9 | 18-96 | None |
| A0A3Q2QY83 | 2-94 | None |
| A0A182ETY8 | 6-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.