DPCstruct | MC25798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 132 ± 10 aa |
| Standard deviation of domain lengths | 9.78 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0586 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7TCG6 | 2-117 | VCYSGVISRCVFPEAGVYELDGRIMLYIAHQPCTGFARGMRVGARVALYNFHLCKANKRVVGFGCCTLSTVRVTEFSPLVSPWKPFQ… |
| A0A1A8PQU7 | 3-128 | KHSRVISYQGTVTEVVNEGAGLYVIDRTVGLCVAYQPSARRRLRAGDQVELHHVHFLYRPCADLPPSMLCCCLSSSLRVTTFSRLEG… |
| R7QD42 | 347-493 | None |
| J3MX24 | 157-287 | None |
| A0A8B6BRU5 | 323-447 | None |
| A0A210PYP9 | 1-147 | None |
| L8GGW4 | 268-405 | None |
| A0A287RDL7 | 186-313 | None |
| A0A6A4S378 | 266-400 | None |
| A0A4W5QZA4 | 130-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.