DPCstruct | MC25797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 137 ± 28 aa |
| Standard deviation of domain lengths | 27.76 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.50 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | CL0061- PF03016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6ZYN1 | 515-626 | VVQLPESSLSSKPHNLKCTYWDCFNIYRCGQTGHDRISVYVYPLKNFVDSKQVPATDVMSKQYYMILESIIESKYYTANPQEACLFV… |
| A0A182GFQ9 | 21-176 | NRYLVAFIAALVLLALWFGGNSVSEADGERLSLDLVDIPQIVLDKDAELARARNRNCSYWDCFNVYRCGQRGLAGTEEHERISIYVY… |
| A0A183DZ05 | 3-148 | None |
| A0A4C1W6M3 | 5-148 | None |
| A0A4Z2CTJ6 | 219-377 | None |
| A0A0Q9W3L9 | 5-174 | None |
| A0A811LE60 | 26-180 | None |
| A0A553ML67 | 41-166 | None |
| A0A7R8D6K8 | 355-506 | None |
| A0A812B1W4 | 210-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.