DPCstruct | MC25794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 111 ± 12 aa |
| Standard deviation of domain lengths | 11.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.77 |
| Pfam Score | 81.85 |
| Assigned Pfam label(s) | PF21322- CL0167- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7K9T7 | 282-388 | GWCNNIAWNTAPLDVDVFKLAIERYEFNKLQSYKSIVPMVHLCWNLAKNVKLKDEALHSLIKYVCMKSLQHTGRIENLMSSKGKHIV… |
| A7TA53 | 1-107 | GWCNNIAWNVGPLTETIFNIAIERYEWNKLQGEKSMVAMIHLAWNLARNIKITEKALYDHIKLILDRSYKYSLVTIENLNRGGIDVK… |
| A0A3P8UTY8 | 561-660 | None |
| A0A803VMQ2 | 168-289 | None |
| A0A369SHX2 | 752-870 | None |
| A0A3P7D648 | 106-215 | None |
| A0A4Z2ENV3 | 1-100 | None |
| E2AX55 | 875-973 | None |
| A0A818BGF4 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.