DPCstruct | MC25793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 107 ± 9 aa |
| Standard deviation of domain lengths | 8.70 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 33.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U7Q6U0 | 500-602 | HAPSDSAQPEFLQDSLEQLVAIMKTYDTSLASPDSRESGFAPILTEALDPFLSGCEEMAAKAASPVDSLIFMINCLSAARETLSTYD… |
| A7T9T9 | 1-106 | IELPPPDLGPTESLKDTLNLLRAVLTSHDASVVPLDARQADYSRIISCIIDPALQMCVLSASHLNVPDMAAYMINCIHQMHTTLAVY… |
| A0A0P4W1S5 | 17-116 | None |
| U4U057 | 893-991 | None |
| A0A820ZJK9 | 166-271 | None |
| A0A1J1J0C9 | 730-847 | None |
| A0A2S2Q660 | 22-120 | None |
| A0A7M5XM40 | 1-126 | None |
| A0A158P5W3 | 323-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.