DPCstruct | MC25792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 153 ± 21 aa |
| Standard deviation of domain lengths | 20.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7T9K6 | 2-131 | VSATIISISRLVFEFRGDIPSKVVEQLIESVLVCLKSKTKEVIKSALGFLKVVISVMSREDLAPYARDLASGIVTWNEDNRRRFRYN… |
| A0A433PLK7 | 1-133 | MVTAGLAGSTPHMISATITSLSRLLFEFKAFLNPSLVSDLLKTMQMFVESSNREIVKSALGFVKVATVSLEPELLQPHLSQIVQGIL… |
| A0A7S1Y090 | 4-169 | None |
| A0A6P5RP39 | 1-132 | None |
| A0A512UF89 | 38-207 | None |
| A0A6A6LT04 | 3-156 | None |
| A0A0M0K010 | 608-737 | None |
| A0A6P7FIB0 | 93-231 | None |
| A0A4Y8D6S6 | 534-717 | None |
| A0A068V0N5 | 179-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.