DPCstruct | MC25791
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 141 ± 21 aa |
| Standard deviation of domain lengths | 21.37 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7JWP2 | 5-145 | KISLFIISSLVCAFVTLTFYKRYRYGFDRNYVEQKLSLYSEESFYFSFYNDIVKSNTFGEGINYLLKDNRSEYPDTINAIKRFNIYP… |
| A7T9H8 | 1-132 | MAWIAVYGVDSCGWLCMVWIAVDGVDSCVCWHVSRMFENERFFSHLSALERELSFRTEMGLYYSYYKTMVEAPTFLDGLHAVMNCNV… |
| A0A7J7RKZ9 | 63-195 | None |
| A0A6P4ZH32 | 26-168 | None |
| A0A6V7U0G3 | 1-129 | None |
| A0A6J1W7F3 | 9-150 | None |
| A0A0K0ECD4 | 23-157 | None |
| A0A6F9CBF6 | 84-201 | None |
| A0A813DFI8 | 2-151 | None |
| A0A4Z2DJE9 | 34-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.