DPCstruct | MC25790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 5.44 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 56.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11708 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R1PM75 | 315-382 | LTQTERYVEYSRHGQVVKGGGGQHSHKSQYVEDVYPNNHTSVWGSYWKDGKWGYKCCHQFFKNSYCVP |
| A0A1I8A9K1 | 100-170 | LPQQTEQYVEYSRTGNVVKGQEKATAKSRFDEDVYPMNHTSVWGSYWEDGKWGFKCCRATMKNAYCTRVAK |
| A0A058Z8W3 | 176-257 | None |
| W9RB90 | 26-91 | None |
| A0A1I8JSB6 | 688-754 | None |
| A0A367JD79 | 352-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.