DPCstruct | MC25786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 155 ± 16 aa |
| Standard deviation of domain lengths | 16.07 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M8FU49 | 2-128 | NQIRKMYSESEVKDQWANCEATQIHHIFPKSKFPQLAHYLENLIKLTATQHYTKAHPNNKTDSINTDYQLVCLLAKSDSIEKSLKRN… |
| F9PEA0 | 1-183 | METRVEYNSTIKHYQAKAIEKYAVNKAKRQIRQFNDRWRNGVSEVKQSTELVKATQAHHIFPQSLFPEIADYLENLIMITPNQHFIM… |
| I9VXV4 | 109-261 | None |
| A0A0Y6UKC5 | 144-294 | None |
| A0A4Y4U2B1 | 114-287 | None |
| A0A6M4P6P4 | 266-398 | None |
| A0A1G9LTX9 | 337-483 | None |
| M3QCY8 | 1-154 | None |
| J0RQZ5 | 157-334 | None |
| A0A7T4A0V6 | 231-392 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.