DPCstruct | MC25781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 161 ± 17 aa |
| Standard deviation of domain lengths | 16.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849V7J7 | 1-153 | MTVMANESYEDFVSQLQKEIEDEGGIKFGVVEKHLFANIVIETEAHKPAFLGADTSEKIWGHLFDHQYIDKNGKVQDKLRTDIKTNK… |
| A0A2G6EZW5 | 71-237 | VYGHDVNLLTVMASESYEHFTKGLQGEMEQASGSKFGVVSKDDFSAITYTDENDKLQNVNKNQSAKLWGELKENGYLSNQGKVTDTL… |
| A0A455V2J4 | 41-196 | None |
| A0A806QLN6 | 96-276 | None |
| A0A855HRZ5 | 313-491 | None |
| A0A1W9PKM2 | 66-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.