DPCstruct | MC25780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 108 ± 15 aa |
| Standard deviation of domain lengths | 14.91 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10947 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448TT73 | 1-114 | MAREVFLKNNMGVVKSGYVGFSWTVFFFGCFAPLFRGNFSWFLIMAFVGIVRVIAERLPPEYYASSNGQMWFSIIFIVIHLFFSFTY… |
| A0A372JUQ6 | 2-99 | TERIYLRHPSQDETVAVGIGFSWPALLLGFIWALMKRLWGIAAFMLAVDLALGLIGLAGVSADLISLALSIVFAIYCGMRANDWHRR… |
| A0A6M1VS67 | 1-94 | None |
| A0A344W9E2 | 24-161 | None |
| G2KUA4 | 1-93 | None |
| A0A1I6M0D5 | 5-107 | None |
| A0A356FXE4 | 15-132 | None |
| B6WXQ0 | 3-108 | None |
| A0A0R1SFT1 | 16-105 | None |
| A0A3M3MK52 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.