DPCstruct | MC2578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 214 ± 20 aa |
| Standard deviation of domain lengths | 20.46 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06748 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257PZF7 | 67-280 | AIGAFTTAVRSATSIKQLLSNPNVMNVLLTANGMKDQIGYTALATQVLMSNLSDPKSLANTLTDTRWKTLAQTYNFNTKGLAAIQNP… |
| N6V1F8 | 2-203 | ADKKLTDFILVANNIDPKTVDKNTLKKAFTSDPEDAKGFLNSPAGQKFKAMVSVFNFDSKGNLTNSKISTSQNKGTRLATDDLYLHQ… |
| A0A516H6P1 | 268-481 | None |
| A0A1V2ARI1 | 1-207 | None |
| A0A5B8B794 | 581-798 | None |
| A0A525IKR5 | 106-317 | None |
| A0A2U1WSD0 | 32-230 | None |
| A0A2E2PBU1 | 8-227 | None |
| A0A1Y5TSS4 | 201-386 | None |
| A0A6I3KM41 | 464-712 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.