DPCstruct | MC25779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 109 ± 7 aa |
| Standard deviation of domain lengths | 6.72 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 72.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T0RL47 | 1-114 | MPQLSPVGQAVVNDAVERLGFTPDAVTHVLMALGQGGGTHAQFDLVELGGKGQWSTGGKTMIGDILNTGLHARVAALCADLSSAMAH… |
| A4T4A0 | 1-97 | MTAAPNPEAEHAIADIARRHGLSRDSVLAMAAALRNGGGTMAQFSIPELGGSGQWMRGGMTMVGDMFDHSLKARVDALCNELAQLLS… |
| A0A1W2FAR4 | 1-112 | None |
| A0A037UZS8 | 1-118 | None |
| A0A3S0X7W6 | 1-115 | None |
| A0A7T1HNT9 | 1-103 | None |
| A0A1M5VJW7 | 1-113 | None |
| A0A6G3VSK3 | 1-107 | None |
| H4FBD6 | 1-106 | None |
| A0A7Y6NMM6 | 7-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.