DPCstruct | MC25777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 105 ± 4 aa |
| Standard deviation of domain lengths | 3.76 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 71.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M0VCF8 | 104-209 | WASLNEETGGMNDVLYQLYTITDDLKHLTLAHLFDKPCFLGLLALQADSISGFHSNTHIPVVVGAQMRYEVTGDVLYKQIATSFMDM… |
| A0A1D1Z688 | 278-385 | WSSLNEETGGMNDVLYNLYSITGDPKHLLLAHLFDKPCFLGYLAVQSDNLSGFHANTHIPIVVGAQRRFEVTGDELYKKIGMYFMDI… |
| A0A453SKX0 | 270-376 | None |
| Q7XBE1 | 589-689 | None |
| A0A446YQ86 | 267-373 | None |
| A0A3L6DZQ1 | 99-196 | None |
| A0A0E0LDH3 | 282-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.