DPCstruct | MC25772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 88 ± 9 aa |
| Standard deviation of domain lengths | 9.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 34.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G1HHE9 | 5-98 | FFSQHLLHSLADEGRITLDHNVLTLLSKDRPSFTLEPAFRFTGTVDGKPDPRGLVGTIRSAKDIRDMKAEIYLDSILFEETAYQTVP… |
| A0A7W0VW13 | 5-98 | FISVERLEAWTAEGRALFEGDRMTLTELNRMFAMAPAVCFVTATGQDHDPYDLVGRVKSKAALESMGAEQFANSVIYNDTAYDVIDG… |
| A0A7Y5KY85 | 25-120 | None |
| A0A1V5WYF1 | 29-120 | None |
| A0A661NWK8 | 5-98 | None |
| Q08TP4 | 1-67 | None |
| D0LUD8 | 5-97 | None |
| A0A3M2D689 | 5-83 | None |
| A0A0F6W764 | 7-99 | None |
| A0A1L6LMN9 | 14-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.