DPCstruct | MC25770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 134 ± 18 aa |
| Standard deviation of domain lengths | 18.28 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A017T3I9 | 66-218 | AELSATVSALSEVLIGQGHVPLEAYEKRKHLTVLRENERSGTEAGVMLSDIPDKYALAALPEIDCEARIPLCKARCCALRFALSVQD… |
| A0A7W0VS04 | 4-146 | EVSRRFESLLDALIERGEVPQRFKDHLARIQADEKPRVHLAIYADKYELESPDIDCASRIPLCGARCCSFDVLLSPQDVAEGGVPWV… |
| A0A7Y8LEQ6 | 18-141 | None |
| A0A537XZK4 | 84-224 | None |
| A0A7V8DIM0 | 20-129 | None |
| A0A7W0Y7F3 | 23-177 | None |
| A0A235EZA0 | 215-366 | None |
| A0A7W0Q904 | 34-188 | None |
| K0K3M7 | 119-273 | None |
| A0A661PFG6 | 90-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.